Lineage for d2pqsa1 (2pqs A:1-158)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774100Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2774101Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2774971Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 2774972Protein automated matches [190770] (51 species)
    not a true protein
  7. 2775073Species Cow (Bos taurus) [TaxId:9913] [187995] (2 PDB entries)
  8. 2775075Domain d2pqsa1: 2pqs A:1-158 [167246]
    Other proteins in same PDB: d2pqsa2, d2pqsb2, d2pqsc2, d2pqsd2
    automated match to d1czsa_

Details for d2pqsa1

PDB Entry: 2pqs (more details), 2.4 Å

PDB Description: Crystal Structure of the Bovine Lactadherin C2 Domain
PDB Compounds: (A:) Lactadherin

SCOPe Domain Sequences for d2pqsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pqsa1 b.18.1.0 (A:1-158) automated matches {Cow (Bos taurus) [TaxId: 9913]}
cteplglkdntipnkqitassyyktwglsafswfpyyarldnqgkfnawtaqtnsasewl
qidlgsqkrvtgiitqgardfghiqyvaayrvaygddgvtwteykdpgaseskifpgnmd
nnshkknifetpfqarfvriqpvawhnritlrvellgc

SCOPe Domain Coordinates for d2pqsa1:

Click to download the PDB-style file with coordinates for d2pqsa1.
(The format of our PDB-style files is described here.)

Timeline for d2pqsa1: