SCOPe 2.08: Domain d2pqsa1: 2pqs A:1-158

Lineage for d2pqsa1 (2pqs A:1-158)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families)

5. Family b.18.1.0: automated matches [191481] (1 protein)
   not a true family

6. Protein automated matches [190770] (51 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [187995] (2 PDB entries)

8. Domain d2pqsa1: 2pqs A:1-158 [167246]
   Other proteins in same PDB: d2pqsa2, d2pqsb2, d2pqsc2, d2pqsd2
   automated match to d1czsa_

Details for d2pqsa1

PDB Entry: 2pqs, 2.4 Å

PDB Description: Crystal Structure of the Bovine Lactadherin C2 Domain

PDB Compounds: (A:) Lactadherin

SCOPe Domain Sequences for d2pqsa1:

Sequence; same for both SEQRES and ATOM records:

>d2pqsa1 b.18.1.0 (A:1-158) automated matches {Cow (Bos taurus) [TaxId: 9913]}
cteplglkdntipnkqitassyyktwglsafswfpyyarldnqgkfnawtaqtnsasewl
qidlgsqkrvtgiitqgardfghiqyvaayrvaygddgvtwteykdpgaseskifpgnmd
nnshkknifetpfqarfvriqpvawhnritlrvellgc

Timeline for d2pqsa1:

• d2pqsa1 first appeared in SCOPe 2.01, called d2pqsa_
  
• d2pqsa1 appears in SCOPe 2.07