Lineage for d2pqca_ (2pqc A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2957073Fold d.68: IF3-like [55199] (8 superfamilies)
    beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest
  4. 2957090Superfamily d.68.2: EPT/RTPC-like [55205] (3 families) (S)
  5. 2957100Family d.68.2.2: Enolpyruvate transferase, EPT [55209] (3 proteins)
    duplication: 6 repeats of this fold are organized in two RPTC-like domains
    automatically mapped to Pfam PF00275
  6. 2957101Protein 5-enol-pyruvyl shikimate-3-phosphate (EPSP) synthase [55213] (4 species)
  7. 2957102Species Agrobacterium sp. [TaxId:268951] [187750] (6 PDB entries)
  8. 2957103Domain d2pqca_: 2pqc A: [167243]
    automated match to d1rf4a_
    complexed with rc1

Details for d2pqca_

PDB Entry: 2pqc (more details), 1.6 Å

PDB Description: CP4 EPSPS liganded with (R)-phosphonate tetrahedral reaction intermediate analog
PDB Compounds: (A:) 3-phosphoshikimate 1-carboxyvinyltransferase

SCOPe Domain Sequences for d2pqca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pqca_ d.68.2.2 (A:) 5-enol-pyruvyl shikimate-3-phosphate (EPSP) synthase {Agrobacterium sp. [TaxId: 268951]}
ssrpatarkssglsgtvripgdksishrsfmfgglasgetritgllegedvintgkamqa
mgarirkegdtwiidgvgnggllapeapldfgnaatgcrltmglvgvydfdstfigdasl
tkrpmgrvlnplremgvqvksedgdrlpvtlrgpktptpityrvpmasaqvksavllagl
ntpgittviepimtrdhtekmlqgfganltvetdadgvrtirlegrgkltgqvidvpgdp
sstafplvaallvpgsdvtilnvlmnptrtgliltlqemgadievinprlaggedvadlr
vrsstlkgvtvpedrapsmideypilavaaafaegatvmngleelrvkesdrlsavangl
klngvdcdegetslvvrgrpdgkglgnasgaavathldhriamsflvmglvsenpvtvdd
atmiatsfpefmdlmaglgakiels

SCOPe Domain Coordinates for d2pqca_:

Click to download the PDB-style file with coordinates for d2pqca_.
(The format of our PDB-style files is described here.)

Timeline for d2pqca_: