SCOPe 2.07: Domain d2pq0a_: 2pq0 A:

Lineage for d2pq0a_ (2pq0 A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.0: automated matches [191369] (1 protein)
   not a true family

6. Protein automated matches [190447] (52 species)
   not a true protein

7. Species Geobacillus kaustophilus [TaxId:235909] [188431] (1 PDB entry)

8. Domain d2pq0a_: 2pq0 A: [167239]
   automated match to d1ymqa1

Details for d2pq0a_

PDB Entry: 2pq0, 2.6 Å

PDB Description: Crystal structure of Hyopthetical protein (gk_1056) from geobacillus Kaustophilus HTA426

PDB Compounds: (A:) Hypothetical conserved protein GK1056

SCOPe Domain Sequences for d2pq0a_:

Sequence; same for both SEQRES and ATOM records:

>d2pq0a_ c.108.1.0 (A:) automated matches {Geobacillus kaustophilus [TaxId: 235909]}
grkivffdidgtlldeqkqlplstieavrrlkqsgvyvaiatgrapfmfehvrkqlgids
fvsfngqyvvfegnvlykqplrrekvralteeahknghplvfmdaekmrasigdhphihv
smaslkfahppvdplyyenkdiyqallfcraeeeepyvrnypefrfvrwhdvstdvlpag
gskaegirmmieklgidkkdvyafgdglndiemlsfvgtgvamgnaheevkrvadfvtkp
vdkegiwyglkqlqli

Timeline for d2pq0a_:

• d2pq0a_ first appeared in SCOPe 2.01
  
• d2pq0a_ appears in SCOPe 2.06