Lineage for d2ppva_ (2ppv A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2923574Fold c.143: CofD-like [142337] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 3214567; topological similarity to the CobT-like fold (52732)
  4. 2923575Superfamily c.143.1: CofD-like [142338] (2 families) (S)
  5. 2923600Family c.143.1.0: automated matches [191480] (1 protein)
    not a true family
  6. 2923601Protein automated matches [190769] (1 species)
    not a true protein
  7. 2923602Species Staphylococcus epidermidis [TaxId:176280] [187994] (1 PDB entry)
  8. 2923603Domain d2ppva_: 2ppv A: [167238]
    automated match to d2hzba1
    complexed with po4

Details for d2ppva_

PDB Entry: 2ppv (more details), 2 Å

PDB Description: crystal structure of a protein belonging to the upf0052 (se_0549) from staphylococcus epidermidis atcc 12228 at 2.00 a resolution
PDB Compounds: (A:) Uncharacterized protein

SCOPe Domain Sequences for d2ppva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ppva_ c.143.1.0 (A:) automated matches {Staphylococcus epidermidis [TaxId: 176280]}
kqmnvvligggtglsvlarglrefpiditaivtvadnggstgkirdvmdipapgdirnvi
aalsdsesiltqlfqyrfgenqvdghslgnlviagmtnitndfghaikelskvlnikgqv
ipstnasvqlnavmedgeivhgetnipkthkkidrvflepsdvepmneaiealeqadliv
lgpgslytsvisnlcvkgiseallrtsapklyvsnvmtqpgetdnydvkehidaltrqvg
epfidfvicssesyskdvlqryeeknskpvavhkeqlkdsgirvltasnlveisnehyvr
hntkvlskmiyelaleltstirftp

SCOPe Domain Coordinates for d2ppva_:

Click to download the PDB-style file with coordinates for d2ppva_.
(The format of our PDB-style files is described here.)

Timeline for d2ppva_: