![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.143: CofD-like [142337] (1 superfamily) 3 layers: a/b/a, parallel beta-sheet of 7 strands, order 3214567; topological similarity to the CobT-like fold (52732) |
![]() | Superfamily c.143.1: CofD-like [142338] (2 families) ![]() |
![]() | Family c.143.1.0: automated matches [191480] (1 protein) not a true family |
![]() | Protein automated matches [190769] (1 species) not a true protein |
![]() | Species Staphylococcus epidermidis [TaxId:176280] [187994] (1 PDB entry) |
![]() | Domain d2ppva_: 2ppv A: [167238] automated match to d2hzba1 complexed with po4 |
PDB Entry: 2ppv (more details), 2 Å
SCOPe Domain Sequences for d2ppva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ppva_ c.143.1.0 (A:) automated matches {Staphylococcus epidermidis [TaxId: 176280]} kqmnvvligggtglsvlarglrefpiditaivtvadnggstgkirdvmdipapgdirnvi aalsdsesiltqlfqyrfgenqvdghslgnlviagmtnitndfghaikelskvlnikgqv ipstnasvqlnavmedgeivhgetnipkthkkidrvflepsdvepmneaiealeqadliv lgpgslytsvisnlcvkgiseallrtsapklyvsnvmtqpgetdnydvkehidaltrqvg epfidfvicssesyskdvlqryeeknskpvavhkeqlkdsgirvltasnlveisnehyvr hntkvlskmiyelaleltstirftp
Timeline for d2ppva_: