SCOPe 2.07: Domain d2ppva_: 2ppv A:

Lineage for d2ppva_ (2ppv A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.143: CofD-like [142337] (1 superfamily)
   3 layers: a/b/a, parallel beta-sheet of 7 strands, order 3214567; topological similarity to the CobT-like fold (52732)

4. Superfamily c.143.1: CofD-like [142338] (2 families)

5. Family c.143.1.0: automated matches [191480] (1 protein)
   not a true family

6. Protein automated matches [190769] (1 species)
   not a true protein

7. Species Staphylococcus epidermidis [TaxId:176280] [187994] (1 PDB entry)

8. Domain d2ppva_: 2ppv A: [167238]
   automated match to d2hzba1
   complexed with po4

Details for d2ppva_

PDB Entry: 2ppv, 2 Å

PDB Description: crystal structure of a protein belonging to the upf0052 (se_0549) from staphylococcus epidermidis atcc 12228 at 2.00 a resolution

PDB Compounds: (A:) Uncharacterized protein

SCOPe Domain Sequences for d2ppva_:

Sequence; same for both SEQRES and ATOM records:

>d2ppva_ c.143.1.0 (A:) automated matches {Staphylococcus epidermidis [TaxId: 176280]}
kqmnvvligggtglsvlarglrefpiditaivtvadnggstgkirdvmdipapgdirnvi
aalsdsesiltqlfqyrfgenqvdghslgnlviagmtnitndfghaikelskvlnikgqv
ipstnasvqlnavmedgeivhgetnipkthkkidrvflepsdvepmneaiealeqadliv
lgpgslytsvisnlcvkgiseallrtsapklyvsnvmtqpgetdnydvkehidaltrqvg
epfidfvicssesyskdvlqryeeknskpvavhkeqlkdsgirvltasnlveisnehyvr
hntkvlskmiyelaleltstirftp

Timeline for d2ppva_:

• d2ppva_ first appeared in SCOPe 2.01
  
• d2ppva_ appears in SCOPe 2.06