SCOPe 2.06: Domain d2poea1: 2poe A:19-177

Lineage for d2poea1 (2poe A:19-177)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.62: Cyclophilin-like [50890] (1 superfamily)
   barrel, closed; n=8, S=10; complex topology

4. Superfamily b.62.1: Cyclophilin-like [50891] (5 families)

5. Family b.62.1.0: automated matches [191372] (1 protein)
   not a true family

6. Protein automated matches [190450] (5 species)
   not a true protein

7. Species Cryptosporidium parvum [TaxId:353152] [187363] (3 PDB entries)

8. Domain d2poea1: 2poe A:19-177 [167234]
   Other proteins in same PDB: d2poea2
   automated match to d1xyha1
   complexed with fmt

Details for d2poea1

PDB Entry: 2poe, 2.01 Å

PDB Description: crystal structure of cryptosporidium parvum cyclophilin type peptidyl- prolyl cis-trans isomerase cgd2_1660

PDB Compounds: (A:) Cyclophilin-like protein, putative

SCOPe Domain Sequences for d2poea1:

Sequence, based on SEQRES records:

>d2poea1 b.62.1.0 (A:19-177) automated matches {Cryptosporidium parvum [TaxId: 353152]}
vriitnygdlkfelfcsqcpkacknflalsasgyykntifhknikgfiiqggdptgtgkg
gesiygryfddeiypelkydrrgilsmaskgaskkpntngsqffitysslpqlngeyvif
gklidgfetlntlencpsdkshkpideiiikdivihsnp

Sequence, based on observed residues (ATOM records):

>d2poea1 b.62.1.0 (A:19-177) automated matches {Cryptosporidium parvum [TaxId: 353152]}
vriitnygdlkfelfcsqcpkacknflalsasgyykntifhknikgfiiqggdptgtgkg
gesiygryfddeiypelkydrrgilsmaskgakkpntngsqffitysslpqlngeyvifg
klidgfetlntlencpsdkshkpideiiikdivihsnp

Timeline for d2poea1:

• d2poea1 first appeared in SCOPe 2.01, called d2poea_
  
• d2poea1 was called d2poea_ in SCOPe 2.05
  
• d2poea1 appears in SCOPe 2.07
  
• d2poea1 appears in the current release, SCOPe 2.08