SCOPe 2.07: Domain d2po7a_: 2po7 A:

Lineage for d2po7a_ (2po7 A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.92: Chelatase-like [53799] (3 superfamilies)
   duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.92.1: Chelatase [53800] (4 families)
   interdomain linker is short; swapping of C-terminal helices between the two domains

5. Family c.92.1.1: Ferrochelatase [53801] (2 proteins)
   automatically mapped to Pfam PF00762

6. Protein Ferrochelatase [53802] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [64189] (21 PDB entries)

8. Domain d2po7a_: 2po7 A: [167232]
   automated match to d1hrka_
   complexed with chd, fes; mutant

Details for d2po7a_

PDB Entry: 2po7, 2.2 Å

PDB Description: crystal structure of human ferrochelatase mutant with his 341 replaced by cys

PDB Compounds: (A:) Ferrochelatase, mitochondrial

SCOPe Domain Sequences for d2po7a_:

Sequence; same for both SEQRES and ATOM records:

>d2po7a_ c.92.1.1 (A:) Ferrochelatase {Human (Homo sapiens) [TaxId: 9606]}
rkpktgilmlnmggpetlgdvhdfllrlfldqdlmtlpiqnklapfiakrltpkiqeqyr
rigggspikiwtskqgegmvklldelspntaphkyyigfryvhplteeaieemerdgler
aiaftqypqyscsttgsslnaiyryynqvgrkptmkwstidrwpthhlliqcfadhilke
ldhfplekrsevvilfsahslpmsvvnrgdpypqevsatvqkvmerleycnpyrlvwqsk
vgpmpwlgpqtdesikglcergrknillvpiaftsdcietlyeldieysqvlakecgven
irraeslngnplfskaladlvhshiqsnelcskqltlscplcvnpvcretksfftsqql

Timeline for d2po7a_:

• d2po7a_ first appeared in SCOPe 2.01
  
• d2po7a_ appears in SCOPe 2.06