SCOPe 2.06: Domain d2pnta_: 2pnt A:

Lineage for d2pnta_ (2pnt A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.0: automated matches [191362] (1 protein)
   not a true family

6. Protein automated matches [190436] (8 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187333] (97 PDB entries)

8. Domain d2pnta_: 2pnt A: [167228]
   automated match to d1q3oa_
   complexed with cl

Details for d2pnta_

PDB Entry: 2pnt, 2.15 Å

PDB Description: crystal structure of the pdz domain of human grasp (grp1) in complex with the c-terminal peptide of the metabotropic glutamate receptor type 1

PDB Compounds: (A:) General receptor for phosphoinositides 1-associated scaffold protein

SCOPe Domain Sequences for d2pnta_:

Sequence, based on SEQRES records:

>d2pnta_ b.36.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qqrkvltlekednqtfgfeiqtyglhhreeqrvemvtfvcrvhesspaqlagltpgdtia
svnglnvegirhreivdiikasgnvlrletlysstl

Sequence, based on observed residues (ATOM records):

>d2pnta_ b.36.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qqrkvltlekednqtfgfeiqtyglhvemvtfvcrvhesspaqlagltpgdtiasvngln
vegirhreivdiikasgnvlrletlysstl

Timeline for d2pnta_:

• d2pnta_ first appeared in SCOPe 2.01
  
• d2pnta_ appears in SCOPe 2.05
  
• d2pnta_ appears in SCOPe 2.07
  
• d2pnta_ appears in the current release, SCOPe 2.08, called d2pnta1