SCOPe 2.08: Domain d2pnta1: 2pnt A:97-188

Lineage for d2pnta1 (2pnt A:97-188)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.0: automated matches [191362] (1 protein)
   not a true family

6. Protein automated matches [190436] (9 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187333] (104 PDB entries)

8. Domain d2pnta1: 2pnt A:97-188 [167228]
   Other proteins in same PDB: d2pnta2
   automated match to d1q3oa_
   complexed with cl

Details for d2pnta1

PDB Entry: 2pnt, 2.15 Å

PDB Description: crystal structure of the pdz domain of human grasp (grp1) in complex with the c-terminal peptide of the metabotropic glutamate receptor type 1

PDB Compounds: (A:) General receptor for phosphoinositides 1-associated scaffold protein

SCOPe Domain Sequences for d2pnta1:

Sequence, based on SEQRES records:

>d2pnta1 b.36.1.0 (A:97-188) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qqrkvltlekednqtfgfeiqtyglhhreeqrvemvtfvcrvhesspaqlagltpgdtia
svnglnvegirhreivdiikasgnvlrletly

Sequence, based on observed residues (ATOM records):

>d2pnta1 b.36.1.0 (A:97-188) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qqrkvltlekednqtfgfeiqtyglhvemvtfvcrvhesspaqlagltpgdtiasvngln
vegirhreivdiikasgnvlrletly

Timeline for d2pnta1:

• d2pnta1 first appeared in SCOPe 2.01, called d2pnta_
  
• d2pnta1 was called d2pnta_ in SCOPe 2.07