SCOPe 2.06: Domain d2pnha_: 2pnh A:

Lineage for d2pnha_ (2pnh A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families)

5. Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (13 proteins)
   barrel, closed; n=5, S=10

6. Protein automated matches [190206] (9 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [187026] (3 PDB entries)

8. Domain d2pnha_: 2pnh A: [167222]
   automated match to d1v1qa_

Details for d2pnha_

PDB Entry: 2pnh, 2.25 Å

PDB Description: escherichia coli prib e39a variant

PDB Compounds: (A:) primosomal replication protein n

SCOPe Domain Sequences for d2pnha_:

Sequence, based on SEQRES records:

>d2pnha_ b.40.4.3 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
mtnrlvlsgtvcraplrkvspsgiphcqfvlehrsvqeaagfhrqawcqmpvivsghenq
aithsitvgsritvqgfischkaknglskmvlhaeqieli

Sequence, based on observed residues (ATOM records):

>d2pnha_ b.40.4.3 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
mtnrlvlsgtvcraplrkvspsgiphcqfvlehrsvqeaagfhrqawcqmpvivsghenq
aithsitvgsritvqgfischklskmvlhaeqieli

Timeline for d2pnha_:

• d2pnha_ first appeared in SCOPe 2.01
  
• d2pnha_ appears in SCOPe 2.05
  
• d2pnha_ appears in SCOPe 2.07
  
• d2pnha_ appears in the current release, SCOPe 2.08