Lineage for d1dpsg_ (1dps G:)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 151499Fold a.25: Ferritin-like [47239] (1 superfamily)
  4. 151500Superfamily a.25.1: Ferritin-like [47240] (2 families) (S)
  5. 151501Family a.25.1.1: Ferritin [47241] (5 proteins)
  6. 151583Protein Dodecameric ferritin homolog [47250] (4 species)
  7. 151594Species Escherichia coli, Dps [TaxId:562] [47251] (1 PDB entry)
  8. 151601Domain d1dpsg_: 1dps G: [16722]

Details for d1dpsg_

PDB Entry: 1dps (more details), 1.6 Å

PDB Description: the crystal structure of dps, a ferritin homolog that binds and protects dna

SCOP Domain Sequences for d1dpsg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dpsg_ a.25.1.1 (G:) Dodecameric ferritin homolog {Escherichia coli, Dps}
llytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrtal
idhldtmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivandvr
kaigeakdddtadiltaasrdldkflwfiecnie

SCOP Domain Coordinates for d1dpsg_:

Click to download the PDB-style file with coordinates for d1dpsg_.
(The format of our PDB-style files is described here.)

Timeline for d1dpsg_: