Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (8 families) |
Family c.23.1.0: automated matches [191324] (1 protein) not a true family |
Protein automated matches [190131] (86 species) not a true protein |
Species Helicobacter pylori [TaxId:210] [187991] (1 PDB entry) |
Domain d2plna1: 2pln A:1-114 [167209] Other proteins in same PDB: d2plna2 automated match to d2pkxa1 |
PDB Entry: 2pln (more details), 1.8 Å
SCOPe Domain Sequences for d2plna1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2plna1 c.23.1.0 (A:1-114) automated matches {Helicobacter pylori [TaxId: 210]} mrvllieknsvlggeiekglnvkgfmadvtesledgeylmdirnydlvmvsdknalsfvs rikekhssivvlvssdnptseeevhafeqgaddyiakpyrsikalvariearlr
Timeline for d2plna1: