Lineage for d2plna1 (2pln A:1-114)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2855424Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2855811Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 2855812Protein automated matches [190131] (86 species)
    not a true protein
  7. 2855982Species Helicobacter pylori [TaxId:210] [187991] (1 PDB entry)
  8. 2855983Domain d2plna1: 2pln A:1-114 [167209]
    Other proteins in same PDB: d2plna2
    automated match to d2pkxa1

Details for d2plna1

PDB Entry: 2pln (more details), 1.8 Å

PDB Description: Crystal structure analysis of HP1043, an orphan resonse regulator of h. pylori
PDB Compounds: (A:) Response regulator

SCOPe Domain Sequences for d2plna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2plna1 c.23.1.0 (A:1-114) automated matches {Helicobacter pylori [TaxId: 210]}
mrvllieknsvlggeiekglnvkgfmadvtesledgeylmdirnydlvmvsdknalsfvs
rikekhssivvlvssdnptseeevhafeqgaddyiakpyrsikalvariearlr

SCOPe Domain Coordinates for d2plna1:

Click to download the PDB-style file with coordinates for d2plna1.
(The format of our PDB-style files is described here.)

Timeline for d2plna1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2plna2