SCOPe 2.07: Domain d2pkta1: 2pkt A:1-90

Lineage for d2pkta1 (2pkt A:1-90)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.1: PDZ domain [50157] (47 proteins)
   Pfam PF00595

6. Protein automated matches [190055] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187785] (61 PDB entries)

8. Domain d2pkta1: 2pkt A:1-90 [167208]
   Other proteins in same PDB: d2pkta2
   automated match to d1rgwa_
   complexed with act, ca, cl, peg, pg4

Details for d2pkta1

PDB Entry: 2pkt, 1.5 Å

PDB Description: crystal structure of the human clp-36 (pdlim1) bound to the c-terminal peptide of human alpha-actinin-1

PDB Compounds: (A:) PDZ and LIM domain protein 1

SCOPe Domain Sequences for d2pkta1:

Sequence; same for both SEQRES and ATOM records:

>d2pkta1 b.36.1.1 (A:1-90) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mttqqidlqgpgpwgfrlvggkdfeqplaisrvtpgskaalanlcigdvitaidgentsn
mthleaqnrikgctdnltltvarsehesdl

Timeline for d2pkta1:

• d2pkta1 first appeared in SCOPe 2.01, called d2pkta_
  
• d2pkta1 appears in SCOPe 2.06
  
• d2pkta1 appears in the current release, SCOPe 2.08