SCOPe 2.05: Domain d2pkoa_: 2pko A:

Lineage for d2pkoa_ (2pko A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.3: MoaD/ThiS [54285] (5 families)
   possible link between the ubiquitin-like and 2Fe-2S ferredoxin-like superfamilies

5. Family d.15.3.0: automated matches [191373] (1 protein)
   not a true family

6. Protein automated matches [190452] (2 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187365] (3 PDB entries)

8. Domain d2pkoa_: 2pko A: [167206]
   automated match to d1xo3a_

Details for d2pkoa_

PDB Entry: 2pko, 1.8 Å

PDB Description: Crystal structure of yeast Urm1 at 1.8 A resolution

PDB Compounds: (A:) Ubiquitin-related modifier 1

SCOPe Domain Sequences for d2pkoa_:

Sequence; same for both SEQRES and ATOM records:

>d2pkoa_ d.15.3.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mvnvkveflggldaifgkqrvhkikmdkedpvtvgdlidhivstminnpndvsifiedds
irpgiitlindtdwelegekdyiledgdiisftstlhgg

Timeline for d2pkoa_:

• d2pkoa_ first appeared in SCOPe 2.01
  
• d2pkoa_ appears in SCOPe 2.04
  
• d2pkoa_ appears in SCOPe 2.06
  
• d2pkoa_ appears in the current release, SCOPe 2.08