Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.0: automated matches [191359] (1 protein) not a true family |
Protein automated matches [190417] (18 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187449] (19 PDB entries) |
Domain d2pk9c_: 2pk9 C: [167205] automated match to d1e9hc_ complexed with mes |
PDB Entry: 2pk9 (more details), 2.91 Å
SCOPe Domain Sequences for d2pk9c_:
Sequence, based on SEQRES records: (download)
>d2pk9c_ d.144.1.0 (C:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} fkqleklgngtyatvykglnkttgvyvalkevkldseegtpstaireislmkelkheniv rlydvihtenkltlvfefmdndlkkymdsrtvgntprglelnlvkyfqwqllqglafche nkilhrdlkpqnllinkrgqlklgdfglarafgipvntfssevvtlwyrapdvlmgsrty stsidiwscgcilaemitgkplfpgtndeeqlklifdimgtpneslwpsvtklpkynpni qqrpprdlrqvlqphtkepldgnlmdflhgllqlnpdmrlsakqalhhpwfaey
>d2pk9c_ d.144.1.0 (C:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} fkqleklatvykgvalkevkgtpstaireislmkelkhenivrlydvihnkltlvfefmd ndlkkymdsglelnlvkyfqwqllqglafchenkilhrdlkpqnllinkrgqlklgdfgl arafgipvntfssevvtlwyrapdvlmgsrtystsidiwscgcilaemitgkplfpgtnd eeqlklifdimgtpneslwpsvtklpkynpniqqrpprdlrqvlqphtkepldgnlmdfl hgllqlnpdmrlsakqalhhpwfaey
Timeline for d2pk9c_: