Class a: All alpha proteins [46456] (285 folds) |
Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily) multihelical; 3 layers or orthogonally packed helices |
Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) |
Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins) |
Protein Steroid hormone receptor ERR1 [109990] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [109991] (3 PDB entries) Uniprot P11474 289-516 |
Domain d2pjlb_: 2pjl B: [167199] automated match to d1xb7a_ complexed with 047 |
PDB Entry: 2pjl (more details), 2.3 Å
SCOPe Domain Sequences for d2pjlb_:
Sequence, based on SEQRES records: (download)
>d2pjlb_ a.123.1.1 (B:) Steroid hormone receptor ERR1 {Human (Homo sapiens) [TaxId: 9606]} levlfqgpvnalvshllvvepeklyampdpagpdghlpavatlsdlfdreivvtiswaks ipgfsslslsdqmsvlqsvwmevlvlgvaqrslplqdelafaedlvldeegaraaglgel gaallqlvrrlqalrlereeyvllkalalansdsvhiedaeaveqlrealhealleyeag ragpgggaerrragrllltlpllrqtagkvlahfygvklegkvpmhklflemleam
>d2pjlb_ a.123.1.1 (B:) Steroid hormone receptor ERR1 {Human (Homo sapiens) [TaxId: 9606]} levlfqgpvnalvshllvvepeklyamlpavatlsdlfdreivvtiswaksipgfsslsl sdqmsvlqsvwmevlvlgvaqrslplqdelafaedlvldeegaraaglgelgaallqlvr rlqalrlereeyvllkalalansdsvhiedaeaveqlrealhealleyeagrrragrlll tlpllrqtagkvlahfygvklegkvpmhklflemleam
Timeline for d2pjlb_: