SCOPe 2.01: Domain d2pjlb_: 2pjl B:

Lineage for d2pjlb_ (2pjl B:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
   multihelical; 3 layers or orthogonally packed helices

4. Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families)

5. Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)

6. Protein Steroid hormone receptor ERR1 [109990] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [109991] (3 PDB entries)
   Uniprot P11474 289-516

8. Domain d2pjlb_: 2pjl B: [167199]
   automated match to d1xb7a_
   complexed with 047

Details for d2pjlb_

PDB Entry: 2pjl, 2.3 Å

PDB Description: crystal structure of human estrogen-related receptor alpha in complex with a synthetic inverse agonist reveals its novel molecular mechanism

PDB Compounds: (B:) Steroid hormone receptor ERR1

SCOPe Domain Sequences for d2pjlb_:

Sequence, based on SEQRES records:

>d2pjlb_ a.123.1.1 (B:) Steroid hormone receptor ERR1 {Human (Homo sapiens) [TaxId: 9606]}
levlfqgpvnalvshllvvepeklyampdpagpdghlpavatlsdlfdreivvtiswaks
ipgfsslslsdqmsvlqsvwmevlvlgvaqrslplqdelafaedlvldeegaraaglgel
gaallqlvrrlqalrlereeyvllkalalansdsvhiedaeaveqlrealhealleyeag
ragpgggaerrragrllltlpllrqtagkvlahfygvklegkvpmhklflemleam

Sequence, based on observed residues (ATOM records):

>d2pjlb_ a.123.1.1 (B:) Steroid hormone receptor ERR1 {Human (Homo sapiens) [TaxId: 9606]}
levlfqgpvnalvshllvvepeklyamlpavatlsdlfdreivvtiswaksipgfsslsl
sdqmsvlqsvwmevlvlgvaqrslplqdelafaedlvldeegaraaglgelgaallqlvr
rlqalrlereeyvllkalalansdsvhiedaeaveqlrealhealleyeagrrragrlll
tlpllrqtagkvlahfygvklegkvpmhklflemleam

Timeline for d2pjlb_:

• d2pjlb_ is new in SCOPe 2.01-stable
  
• d2pjlb_ appears in SCOPe 2.02
  
• d2pjlb_ appears in the current release, SCOPe 2.08, called d2pjlb1