Lineage for d2pjlb1 (2pjl B:289-517)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2728284Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2728285Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2728286Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2729520Protein Steroid hormone receptor ERR1 [109990] (1 species)
  7. 2729521Species Human (Homo sapiens) [TaxId:9606] [109991] (3 PDB entries)
    Uniprot P11474 289-516
  8. 2729526Domain d2pjlb1: 2pjl B:289-517 [167199]
    Other proteins in same PDB: d2pjla2, d2pjlb2
    automated match to d1xb7a_
    complexed with 047

Details for d2pjlb1

PDB Entry: 2pjl (more details), 2.3 Å

PDB Description: crystal structure of human estrogen-related receptor alpha in complex with a synthetic inverse agonist reveals its novel molecular mechanism
PDB Compounds: (B:) Steroid hormone receptor ERR1

SCOPe Domain Sequences for d2pjlb1:

Sequence, based on SEQRES records: (download)

>d2pjlb1 a.123.1.1 (B:289-517) Steroid hormone receptor ERR1 {Human (Homo sapiens) [TaxId: 9606]}
pvnalvshllvvepeklyampdpagpdghlpavatlsdlfdreivvtiswaksipgfssl
slsdqmsvlqsvwmevlvlgvaqrslplqdelafaedlvldeegaraaglgelgaallql
vrrlqalrlereeyvllkalalansdsvhiedaeaveqlrealhealleyeagragpggg
aerrragrllltlpllrqtagkvlahfygvklegkvpmhklflemleam

Sequence, based on observed residues (ATOM records): (download)

>d2pjlb1 a.123.1.1 (B:289-517) Steroid hormone receptor ERR1 {Human (Homo sapiens) [TaxId: 9606]}
pvnalvshllvvepeklyamlpavatlsdlfdreivvtiswaksipgfsslslsdqmsvl
qsvwmevlvlgvaqrslplqdelafaedlvldeegaraaglgelgaallqlvrrlqalrl
ereeyvllkalalansdsvhiedaeaveqlrealhealleyeagrrragrllltlpllrq
tagkvlahfygvklegkvpmhklflemleam

SCOPe Domain Coordinates for d2pjlb1:

Click to download the PDB-style file with coordinates for d2pjlb1.
(The format of our PDB-style files is described here.)

Timeline for d2pjlb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2pjlb2