SCOPe 2.08: Domain d2pjlb1: 2pjl B:289-517

Lineage for d2pjlb1 (2pjl B:289-517)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
   multihelical; 3 layers or orthogonally packed helices

4. Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families)

5. Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)

6. Protein Steroid hormone receptor ERR1 [109990] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [109991] (3 PDB entries)
   Uniprot P11474 289-516

8. Domain d2pjlb1: 2pjl B:289-517 [167199]
   Other proteins in same PDB: d2pjla2, d2pjlb2
   automated match to d1xb7a_
   complexed with 047

Details for d2pjlb1

PDB Entry: 2pjl, 2.3 Å

PDB Description: crystal structure of human estrogen-related receptor alpha in complex with a synthetic inverse agonist reveals its novel molecular mechanism

PDB Compounds: (B:) Steroid hormone receptor ERR1

SCOPe Domain Sequences for d2pjlb1:

Sequence, based on SEQRES records:

>d2pjlb1 a.123.1.1 (B:289-517) Steroid hormone receptor ERR1 {Human (Homo sapiens) [TaxId: 9606]}
pvnalvshllvvepeklyampdpagpdghlpavatlsdlfdreivvtiswaksipgfssl
slsdqmsvlqsvwmevlvlgvaqrslplqdelafaedlvldeegaraaglgelgaallql
vrrlqalrlereeyvllkalalansdsvhiedaeaveqlrealhealleyeagragpggg
aerrragrllltlpllrqtagkvlahfygvklegkvpmhklflemleam

Sequence, based on observed residues (ATOM records):

>d2pjlb1 a.123.1.1 (B:289-517) Steroid hormone receptor ERR1 {Human (Homo sapiens) [TaxId: 9606]}
pvnalvshllvvepeklyamlpavatlsdlfdreivvtiswaksipgfsslslsdqmsvl
qsvwmevlvlgvaqrslplqdelafaedlvldeegaraaglgelgaallqlvrrlqalrl
ereeyvllkalalansdsvhiedaeaveqlrealhealleyeagrrragrllltlpllrq
tagkvlahfygvklegkvpmhklflemleam

Timeline for d2pjlb1:

• d2pjlb1 first appeared in SCOPe 2.01, called d2pjlb_
  
• d2pjlb1 appears in SCOPe 2.07