![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily) core: 4 helices; folded leaf, closed |
![]() | Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) ![]() |
![]() | Family a.35.1.0: automated matches [191534] (1 protein) not a true family |
![]() | Protein automated matches [190907] (21 species) not a true protein |
![]() | Species Pseudomonas fluorescens [TaxId:220664] [188360] (1 PDB entry) |
![]() | Domain d2pijb_: 2pij B: [167197] automated match to d1copd_ complexed with bct, dtt, so4 |
PDB Entry: 2pij (more details), 1.7 Å
SCOPe Domain Sequences for d2pijb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pijb_ a.35.1.0 (B:) automated matches {Pseudomonas fluorescens [TaxId: 220664]} mkkiplskyleehgtqsalaaalgvnqsaisqmvragrsieitlyedgrveaneirpipa
Timeline for d2pijb_: