![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies) superhelix turns are made of parallel beta-strands and (short) turns |
![]() | Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) ![]() superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands |
![]() | Family b.81.1.7: YdcK-like [141583] (2 proteins) part of Pfam PF00132 this is a repeat family; one repeat unit is 2f9c A:267-285 found in domain |
![]() | Protein automated matches [190635] (2 species) not a true protein |
![]() | Species Salmonella paratyphi [TaxId:54388] [187990] (1 PDB entry) |
![]() | Domain d2pigb_: 2pig B: [167195] automated match to d2f9ca1 complexed with zn |
PDB Entry: 2pig (more details), 2.38 Å
SCOPe Domain Sequences for d2pigb_:
Sequence, based on SEQRES records: (download)
>d2pigb_ b.81.1.7 (B:) automated matches {Salmonella paratyphi [TaxId: 54388]} kyrlsegpraftyqvdgekksvllrqviavtdfndvkagtsggwvdadnvlsqqgdcwiy denamafagteitgnaritqpctlynnvrigdnvwidradisdgarisdnvtiqsssvre ecaiygdarvlnqseilaiqglthehaqilqiydratvnhsrivhqvqlygnatithafi ehraevfdfaliegdkdnnvwicdcakvygharviagteedaiptlryssqvaehalieg ncvlkhhvlvgghaevrggpillddrvlieghaciqgeilierqveisgraaviafddnt ihlrgpkvingedritrtplvgsllehh
>d2pigb_ b.81.1.7 (B:) automated matches {Salmonella paratyphi [TaxId: 54388]} kyrlsegpraftyqvdgekksvllrqviavtdfndvkagtsggwvdadnvlsqqgdcwiy denamafagteitgnaritqpctlynnvrigdnvwidradisdgarisdnvtiqsssvre ecaiygdarvlnqseilaiqilqiydratvnhsrivhqvqlygnatithafiehraevfd faliegdkdnnvwicdcakvygharviagteedaiptlryssqvaehaliegncvlkhhv lvgghaevrggpillddrvlieghaciqgeilierqveisgraaviafdntihlrgpkvi ngedritrtplvgsllehh
Timeline for d2pigb_: