Lineage for d2pigb1 (2pig B:3-326)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2069505Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 2069506Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) (S)
    superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands
  5. 2069769Family b.81.1.7: YdcK-like [141583] (2 protein domains)
    part of Pfam PF00132
  6. 2069773Protein automated matches [190635] (2 species)
    not a true protein
  7. 2069776Species Salmonella paratyphi [TaxId:54388] [187990] (1 PDB entry)
  8. 2069778Domain d2pigb1: 2pig B:3-326 [167195]
    Other proteins in same PDB: d2pigb2
    automated match to d2f9ca1
    complexed with zn

Details for d2pigb1

PDB Entry: 2pig (more details), 2.38 Å

PDB Description: crystal structure of ydck from salmonella cholerae at 2.38 a resolution. northeast structural genomics target scr6
PDB Compounds: (B:) Putative transferase

SCOPe Domain Sequences for d2pigb1:

Sequence, based on SEQRES records: (download)

>d2pigb1 b.81.1.7 (B:3-326) automated matches {Salmonella paratyphi [TaxId: 54388]}
kyrlsegpraftyqvdgekksvllrqviavtdfndvkagtsggwvdadnvlsqqgdcwiy
denamafagteitgnaritqpctlynnvrigdnvwidradisdgarisdnvtiqsssvre
ecaiygdarvlnqseilaiqglthehaqilqiydratvnhsrivhqvqlygnatithafi
ehraevfdfaliegdkdnnvwicdcakvygharviagteedaiptlryssqvaehalieg
ncvlkhhvlvgghaevrggpillddrvlieghaciqgeilierqveisgraaviafddnt
ihlrgpkvingedritrtplvgsl

Sequence, based on observed residues (ATOM records): (download)

>d2pigb1 b.81.1.7 (B:3-326) automated matches {Salmonella paratyphi [TaxId: 54388]}
kyrlsegpraftyqvdgekksvllrqviavtdfndvkagtsggwvdadnvlsqqgdcwiy
denamafagteitgnaritqpctlynnvrigdnvwidradisdgarisdnvtiqsssvre
ecaiygdarvlnqseilaiqilqiydratvnhsrivhqvqlygnatithafiehraevfd
faliegdkdnnvwicdcakvygharviagteedaiptlryssqvaehaliegncvlkhhv
lvgghaevrggpillddrvlieghaciqgeilierqveisgraaviafdntihlrgpkvi
ngedritrtplvgsl

SCOPe Domain Coordinates for d2pigb1:

Click to download the PDB-style file with coordinates for d2pigb1.
(The format of our PDB-style files is described here.)

Timeline for d2pigb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2pigb2
View in 3D
Domains from other chains:
(mouse over for more information)
d2piga_