Class b: All beta proteins [48724] (176 folds) |
Fold b.76: open-sided beta-meander [51086] (2 superfamilies) single sheet formed by beta-hairpin repeats; exposed on both sides in the middle |
Superfamily b.76.1: Outer surface protein [51087] (1 family) 21 stranded sheet partly folded upon itself at the ends |
Family b.76.1.1: Outer surface protein [51088] (3 proteins) |
Protein automated matches [190440] (1 species) not a true protein |
Species Lyme disease spirochete (Borrelia burgdorferi) [TaxId:139] [188450] (13 PDB entries) |
Domain d2pi3o_: 2pi3 O: [167191] automated match to d1fj1e_ mutant |
PDB Entry: 2pi3 (more details), 1.4 Å
SCOPe Domain Sequences for d2pi3o_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pi3o_ b.76.1.1 (O:) automated matches {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]} nsvsvdlpgsmkvlvskssnadgkydliatvdalelsgtsdknngsgvlegvkadaskvk ltisddlgqttlevfksdgstlvskfvtskdksstfekfnekgevsekfitradgtrley tgiksdgsgkakevlkgyvlegtltaekttlvvkegtvtlsknisksgevsvelndtdss aatkktaawnsgtstltitvnskktkdlvftssntitvqqydsngtslegsaveitklde iknalk
Timeline for d2pi3o_: