Lineage for d2pi3o_ (2pi3 O:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2068816Fold b.76: open-sided beta-meander [51086] (2 superfamilies)
    single sheet formed by beta-hairpin repeats; exposed on both sides in the middle
  4. 2068817Superfamily b.76.1: Outer surface protein [51087] (1 family) (S)
    21 stranded sheet partly folded upon itself at the ends
  5. 2068818Family b.76.1.1: Outer surface protein [51088] (3 protein domains)
  6. 2068830Protein automated matches [190440] (2 species)
    not a true protein
  7. 2068831Species Lyme disease spirochete (Borrelia burgdorferi) [TaxId:139] [188450] (15 PDB entries)
  8. 2068839Domain d2pi3o_: 2pi3 O: [167191]
    automated match to d1fj1e_
    mutant

Details for d2pi3o_

PDB Entry: 2pi3 (more details), 1.4 Å

PDB Description: The crystal structure of OspA mutant
PDB Compounds: (O:) Outer surface protein A

SCOPe Domain Sequences for d2pi3o_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pi3o_ b.76.1.1 (O:) automated matches {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]}
nsvsvdlpgsmkvlvskssnadgkydliatvdalelsgtsdknngsgvlegvkadaskvk
ltisddlgqttlevfksdgstlvskfvtskdksstfekfnekgevsekfitradgtrley
tgiksdgsgkakevlkgyvlegtltaekttlvvkegtvtlsknisksgevsvelndtdss
aatkktaawnsgtstltitvnskktkdlvftssntitvqqydsngtslegsaveitklde
iknalk

SCOPe Domain Coordinates for d2pi3o_:

Click to download the PDB-style file with coordinates for d2pi3o_.
(The format of our PDB-style files is described here.)

Timeline for d2pi3o_: