SCOPe 2.08: Domain d2ph4b_: 2ph4 B:

Lineage for d2ph4b_ (2ph4 B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
   common core: 2 helices, disulfide-linked, and a calcium-binding loop

4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families)

5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
   automatically mapped to Pfam PF00068

6. Protein automated matches [190139] (27 species)
   not a true protein

7. Species Zhaoermia mangshanensis [TaxId:242058] [188379] (1 PDB entry)

8. Domain d2ph4b_: 2ph4 B: [167188]
   automated match to d1qlla_
   complexed with peg, so4

Details for d2ph4b_

PDB Entry: 2ph4, 2.05 Å

PDB Description: Crystal structure of a novel Arg49 phospholipase A2 homologue from Zhaoermia mangshanensis venom

PDB Compounds: (B:) Zhaoermiatoxin

SCOPe Domain Sequences for d2ph4b_:

Sequence; same for both SEQRES and ATOM records:

>d2ph4b_ a.133.1.2 (B:) automated matches {Zhaoermia mangshanensis [TaxId: 242058]}
slieltkmvfqetgknpvtyytlygcncgvgrrgkpkdatdrccfvhrccykkltgcdpk
kdrysyswenkaivcgeknpclkelcecdkavaiclrknlgtydknyrftmkflcdkpek
c

Timeline for d2ph4b_:

• d2ph4b_ first appeared in SCOPe 2.01
  
• d2ph4b_ appears in SCOPe 2.07