Lineage for d2ph4a_ (2ph4 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2732915Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2732916Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2732921Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 2733305Protein automated matches [190139] (27 species)
    not a true protein
  7. 2733532Species Zhaoermia mangshanensis [TaxId:242058] [188379] (1 PDB entry)
  8. 2733533Domain d2ph4a_: 2ph4 A: [167187]
    automated match to d1qlla_
    complexed with peg, so4

Details for d2ph4a_

PDB Entry: 2ph4 (more details), 2.05 Å

PDB Description: Crystal structure of a novel Arg49 phospholipase A2 homologue from Zhaoermia mangshanensis venom
PDB Compounds: (A:) Zhaoermiatoxin

SCOPe Domain Sequences for d2ph4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ph4a_ a.133.1.2 (A:) automated matches {Zhaoermia mangshanensis [TaxId: 242058]}
slieltkmvfqetgknpvtyytlygcncgvgrrgkpkdatdrccfvhrccykkltgcdpk
kdrysyswenkaivcgeknpclkelcecdkavaiclrknlgtydknyrftmkflcdkpek
c

SCOPe Domain Coordinates for d2ph4a_:

Click to download the PDB-style file with coordinates for d2ph4a_.
(The format of our PDB-style files is described here.)

Timeline for d2ph4a_: