| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily) common core: 2 helices, disulfide-linked, and a calcium-binding loop |
Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) ![]() |
| Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins) automatically mapped to Pfam PF00068 |
| Protein automated matches [190139] (27 species) not a true protein |
| Species Zhaoermia mangshanensis [TaxId:242058] [188379] (1 PDB entry) |
| Domain d2ph4a_: 2ph4 A: [167187] automated match to d1qlla_ complexed with peg, so4 |
PDB Entry: 2ph4 (more details), 2.05 Å
SCOPe Domain Sequences for d2ph4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ph4a_ a.133.1.2 (A:) automated matches {Zhaoermia mangshanensis [TaxId: 242058]}
slieltkmvfqetgknpvtyytlygcncgvgrrgkpkdatdrccfvhrccykkltgcdpk
kdrysyswenkaivcgeknpclkelcecdkavaiclrknlgtydknyrftmkflcdkpek
c
Timeline for d2ph4a_: