Lineage for d2pfva_ (2pfv A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2007926Superfamily a.118.17: Cullin repeat-like [74788] (3 families) (S)
  5. 2007936Family a.118.17.2: Exocyst complex component [140851] (3 protein domains)
    includes Pfam PF03081
  6. 2007937Protein Exocyst complex component EXO70 [140854] (1 species)
  7. 2007938Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [140855] (2 PDB entries)
    Uniprot P19658 73-623
  8. 2007939Domain d2pfva_: 2pfv A: [167170]
    automated match to d2b7ma1

Details for d2pfva_

PDB Entry: 2pfv (more details), 2.1 Å

PDB Description: s. cerevisiae exo70 with additional residues to 2.1 angrstrom resolution
PDB Compounds: (A:) Exocyst complex component EXO70

SCOPe Domain Sequences for d2pfva_:

Sequence, based on SEQRES records: (download)

>d2pfva_ a.118.17.2 (A:) Exocyst complex component EXO70 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tlnsvasvkdlaneaskyeiilqkginqvglkqytqvvhklddmlediqsgqanreense
fhgilthleqlikrseaqlrvyfisilnsikpfdpqinitkkmpfpyyedqqlgalswil
dyfhgnsegsiiqdilvgersklilkcmaflepfakeistaknapyekgssgmnsyteal
lgfianekslvddlysqyteskphvlsqilsplisayaklfganlkivrsnlenfgffsf
elvesindvkkslrgkelqnynllqdctqevrqvtqslfrdaidriikkansistipsnn
gvteatvdtmsrlrkfseykngclgamdnitrenwlpsnykekeytlqnealnwedhnvl
lscfisdcidtlavnlerkaqialmpnqepdvanpnssknkhkqrigffilmnltlveqi
vekselnlmlageghsrlerlkkryisymvsdwrdltanlmdsvfidssgkkskdkeqik
ekfrkfnegfedlvsktkqyklsdpslkvtlkseiislvmpmyerfysrykdsfknprkh
ikytpdelttvlnqlvr

Sequence, based on observed residues (ATOM records): (download)

>d2pfva_ a.118.17.2 (A:) Exocyst complex component EXO70 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tlnsvasvkdlaneaskyeiilqkginqvglkqytqvvhklddmlediqsgqanreense
fhgilthleqlikrseaqlrvyfisilnsikpfdpqinitkkmpfpyyedqqlgalswil
dyfhgnsegsiiqdilvgersklilkcmaflepfakeyekgssgmnsyteallgfianek
slvddlysqyteskphvlsqilsplisayaklfganlkivrsnlenfgffsfelvesind
vkkslrgkelqnynllqdctqevrqvtqslfrdaidriikkansistipsnngvteatvd
tmsrlrkfseykngclgamdnitrenwlpsnykekeytlqnealnwedhnvllscfisdc
idtlavnlerkaqialmpnqepdvanpnssknkhkqrigffilmnltlveqivekselnl
mlageghsrlerlkkryisymvsdwrdltanlmdsvfidssgkkskdkeqikekfrkfne
gfedlvsktkqyklsdpslkvtlkseiislvmpmyerfysrykdsfknprkhikytpdel
ttvlnqlvr

SCOPe Domain Coordinates for d2pfva_:

Click to download the PDB-style file with coordinates for d2pfva_.
(The format of our PDB-style files is described here.)

Timeline for d2pfva_: