Lineage for d2pfmb_ (2pfm B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2010255Fold a.127: L-aspartase-like [48556] (1 superfamily)
    multihelical, consists of three all-alpha domains
  4. 2010256Superfamily a.127.1: L-aspartase-like [48557] (3 families) (S)
  5. 2010257Family a.127.1.1: L-aspartase/fumarase [48558] (6 protein domains)
  6. 2010373Protein automated matches [190147] (7 species)
    not a true protein
  7. 2010379Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [187987] (1 PDB entry)
  8. 2010381Domain d2pfmb_: 2pfm B: [167168]
    automated match to d1f1oa_
    complexed with mli

Details for d2pfmb_

PDB Entry: 2pfm (more details), 2 Å

PDB Description: Crystal Structure of Adenylosuccinate Lyase (PurB) from Bacillus anthracis
PDB Compounds: (B:) adenylosuccinate lyase

SCOPe Domain Sequences for d2pfmb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pfmb_ a.127.1.1 (B:) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
isrytrpemgaiwteenkfkawleveilaceawaelgdipkedvkkirehasfdidriye
ieketrhdvvaftravsetpalgeerkwvhygltstdvvdtalsyilkqaneiilkdlen
fvsilankakehkytimmgrthgvhaepttfglklglwyeemkrnverfkqaantvrvgk
lsgavgtyanidpfvekyvcenlgleaapistqtlqrdrhahymstlaliatsiekmave
irglqksetreveeafakgqkgssamphkrnpigsenmtglarvirgymmtayenvplwh
erdishssaervilpdatialnymlnrfgnivknltvypenmkrnmtrtygliysqrvml
tlidkgmvreeaydivqpkameawetqvqfkelveaderitskltqeeinecfnyehhmq
hvdtiferlglnea

SCOPe Domain Coordinates for d2pfmb_:

Click to download the PDB-style file with coordinates for d2pfmb_.
(The format of our PDB-style files is described here.)

Timeline for d2pfmb_: