Lineage for d2pfea_ (2pfe A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2387558Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2387559Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2390288Family b.47.1.0: automated matches [191364] (1 protein)
    not a true family
  6. 2390289Protein automated matches [190438] (28 species)
    not a true protein
  7. 2390530Species Thermobifida fusca YX [TaxId:269800] [187339] (1 PDB entry)
  8. 2390531Domain d2pfea_: 2pfe A: [167164]
    automated match to d1gbja_
    complexed with aes, gol, so4

Details for d2pfea_

PDB Entry: 2pfe (more details), 1.44 Å

PDB Description: Crystal Structure of Thermobifida fusca Protease A (TFPA)
PDB Compounds: (A:) Alkaline serine protease

SCOPe Domain Sequences for d2pfea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pfea_ b.47.1.0 (A:) automated matches {Thermobifida fusca YX [TaxId: 269800]}
aaiiggnpyyfgnyrcsigfsvrqgsqtgfataghcgstgtrvsspsgtvagsyfpgrdm
gwvritsadtvtplvnrynggtvtvtgsqeaatgssvcrsgattgwrcgtiqsknqtvry
aegtvtgltrttacaeggdsggpwltgsqaqgvtsggtgdcrsggitffqpinpllsyfg
lqlvtg

SCOPe Domain Coordinates for d2pfea_:

Click to download the PDB-style file with coordinates for d2pfea_.
(The format of our PDB-style files is described here.)

Timeline for d2pfea_: