| Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
| Fold f.13: Family A G protein-coupled receptor-like [81322] (1 superfamily) core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membrane |
Superfamily f.13.1: Family A G protein-coupled receptor-like [81321] (3 families) ![]() |
| Family f.13.1.2: Rhodopsin-like [81320] (2 proteins) Individual TM segments have a number of kinks and distortions |
| Protein automated matches [190300] (1 species) not a true protein |
| Species Cow (Bos taurus) [TaxId:9913] [188510] (8 PDB entries) |
| Domain d2peda_: 2ped A: [167161] automated match to d1f88a_ complexed with hg, htg, hto, plm, ret, zn |
PDB Entry: 2ped (more details), 2.95 Å
SCOPe Domain Sequences for d2peda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2peda_ f.13.1.2 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
mngtegpnfyvpfsnktgvvrspfeapqyylaepwqfsmlaaymfllimlgfpinfltly
vtvqhkklrtplnyillnlavadlfmvfggftttlytslhgyfvfgptgcnlegffatlg
geialwslvvlaieryvvvckpmsnfrfgenhaimgvaftwvmalacaapplvgwsryip
egmqcscgidyytpheetnnesfviymfvvhfiipliviffcygqlvftvkeaaaqqqes
attqkaekevtrmviimviaflicwlpyagvafyifthqgsdfgpifmtipaffaktsav
ynpviyimmnkqfrncmvttlccgknplgddeasttvsktetsqvapa
Timeline for d2peda_: