![]() | Class a: All alpha proteins [46456] (179 folds) |
![]() | Fold a.25: Ferritin-like [47239] (2 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
![]() | Superfamily a.25.1: Ferritin-like [47240] (2 families) ![]() contains dimetal-ion centre in the middle of the bundle |
![]() | Family a.25.1.1: Ferritin [47241] (5 proteins) |
![]() | Protein Dodecameric ferritin homolog [47250] (7 species) |
![]() | Species Escherichia coli, Dps [TaxId:562] [47251] (7 PDB entries) ferritin homolog that binds to and protects DNA |
![]() | Domain d1dpsa_: 1dps A: [16716] |
PDB Entry: 1dps (more details), 1.6 Å
SCOP Domain Sequences for d1dpsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dpsa_ a.25.1.1 (A:) Dodecameric ferritin homolog {Escherichia coli, Dps} skatnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldg frtalidhldtmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaiv andvrkaigeakdddtadiltaasrdldkflwfiecnie
Timeline for d1dpsa_: