SCOPe 2.03: Domain d2pd9a_: 2pd9 A:

Lineage for d2pd9a_ (2pd9 A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families)

5. Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins)
   Common fold covers whole protein structure

6. Protein Aldose reductase (aldehyde reductase) [51436] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [51437] (93 PDB entries)
   Uniprot P15121

8. Domain d2pd9a_: 2pd9 A: [167142]
   automated match to d1el3a_
   complexed with fid, nap; mutant

Details for d2pd9a_

PDB Entry: 2pd9, 1.55 Å

PDB Description: human aldose reductase mutant v47i complexed with fidarestat.

PDB Compounds: (A:) aldose reductase

SCOPe Domain Sequences for d2pd9a_:

Sequence; same for both SEQRES and ATOM records:

>d2pd9a_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Human (Homo sapiens) [TaxId: 9606]}
asrillnngakmpilglgtwksppgqvteavkvaidvgyrhidcahiyqnenevgvaiqe
klreqvvkreelfivsklwctyhekglvkgacqktlsdlkldyldlylihwptgfkpgke
ffpldesgnvvpsdtnildtwaameelvdeglvkaigisnfnhlqvemilnkpglkykpa
vnqiechpyltqekliqycqskgivvtaysplgspdrpwakpedpslledprikaiaakh
nkttaqvlirfpmqrnlvvipksvtperiaenfkvfdfelssqdmttllsynrnwrvcal
lsctshkdypfheef

Timeline for d2pd9a_:

• d2pd9a_ first appeared in SCOPe 2.01
  
• d2pd9a_ appears in SCOPe 2.02
  
• d2pd9a_ appears in SCOPe 2.04
  
• d2pd9a_ appears in the current release, SCOPe 2.08