Lineage for d2pd6a1 (2pd6 A:6-259)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2847056Species Human (Homo sapiens) [TaxId:9606] [186944] (65 PDB entries)
  8. 2847072Domain d2pd6a1: 2pd6 A:6-259 [167138]
    Other proteins in same PDB: d2pd6a2
    automated match to d1q7ba_
    complexed with nad

Details for d2pd6a1

PDB Entry: 2pd6 (more details), 2 Å

PDB Description: Structure of human hydroxysteroid dehydrogenase type 8, HSD17B8
PDB Compounds: (A:) Estradiol 17-beta-dehydrogenase 8

SCOPe Domain Sequences for d2pd6a1:

Sequence, based on SEQRES records: (download)

>d2pd6a1 c.2.1.0 (A:6-259) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qnrlrsalalvtgagsgigravsvrlagegatvaacdldraaaqetvrllggpgskegpp
rgnhaafqadvsearaarclleqvqacfsrppsvvvscagitqdefllhmseddwdkvia
vnlkgtflvtqaaaqalvsngcrgsiinissivgkvgnvgqtnyaaskagvigltqtaar
elgrhgircnsvlpgfiatpmtqkvpqkvvdkitemipmghlgdpedvadvvaflaseds
gyitgtsvevtggl

Sequence, based on observed residues (ATOM records): (download)

>d2pd6a1 c.2.1.0 (A:6-259) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qnrlrsalalvtgagsgigravsvrlagegatvaacdldraaaqetvrllnhaafqadvs
earaarclleqvqacfsrppsvvvscagitqdefllhmseddwdkviavnlkgtflvtqa
aaqalvsngcrgsiinissivgkvgnvgqtnyaaskagvigltqtaarelgrhgircnsv
lpgfiatpmkitemipmghlgdpedvadvvaflasedsgyitgtsvevtggl

SCOPe Domain Coordinates for d2pd6a1:

Click to download the PDB-style file with coordinates for d2pd6a1.
(The format of our PDB-style files is described here.)

Timeline for d2pd6a1: