SCOPe 2.05: Domain d2pcjb_: 2pcj B:

Lineage for d2pcjb_ (2pcj B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (96 species)
   not a true protein

7. Species Aquifex aeolicus [TaxId:224324] [188217] (4 PDB entries)

8. Domain d2pcjb_: 2pcj B: [167128]
   automated match to d1f3oa_
   complexed with so3

Details for d2pcjb_

PDB Entry: 2pcj, 1.7 Å

PDB Description: Crystal structure of ABC transporter (aq_297) From Aquifex Aeolicus VF5

PDB Compounds: (B:) Lipoprotein-releasing system ATP-binding protein lolD

SCOPe Domain Sequences for d2pcjb_:

Sequence; same for both SEQRES and ATOM records:

>d2pcjb_ c.37.1.0 (B:) automated matches {Aquifex aeolicus [TaxId: 224324]}
aeilraenikkvirgyeilkgislsvkkgefvsiigasgsgkstllyilglldaptegkv
flegkevdytnekelsllrnrklgfvfqfhylipeltalenvivpmlkmgkpkkeakerg
eyllselglgdklsrkpyelsggeqqrvaiaralanepillfadeptgnldsantkrvmd
iflkineggtsivmvtherelaelthrtlemkdgkvvgeitrv

Timeline for d2pcjb_:

• d2pcjb_ first appeared in SCOPe 2.01
  
• d2pcjb_ appears in SCOPe 2.04
  
• d2pcjb_ appears in SCOPe 2.06
  
• d2pcjb_ appears in the current release, SCOPe 2.08