Lineage for d2pbqc_ (2pbq C:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2466608Fold c.57: Molybdenum cofactor biosynthesis proteins [53217] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands; order: 21354, strand 5 is antiparallel to the rest; permutation of the Phosphorylase/hydrolase-like fold
  4. 2466609Superfamily c.57.1: Molybdenum cofactor biosynthesis proteins [53218] (3 families) (S)
  5. 2466610Family c.57.1.1: MogA-like [53219] (6 protein domains)
  6. 2466682Protein automated matches [190868] (2 species)
    not a true protein
  7. 2466683Species Aquifex aeolicus [TaxId:224324] [188216] (3 PDB entries)
  8. 2466695Domain d2pbqc_: 2pbq C: [167116]
    automated match to d2f7wa1

Details for d2pbqc_

PDB Entry: 2pbq (more details), 1.7 Å

PDB Description: crystal structure of molybdenum cofactor biosynthesis (aq_061) from aquifex aeolicus vf5
PDB Compounds: (C:) Molybdenum cofactor biosynthesis MOG

SCOPe Domain Sequences for d2pbqc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pbqc_ c.57.1.1 (C:) automated matches {Aquifex aeolicus [TaxId: 224324]}
kkavigvvtisdraskgiyedisgkaiidylkdviitpfeveyrvipderdliektliel
adekgcslilttggtgpaprdvtpeateavcekmlpgfgelmrqvslkqvptailsrqta
girgsclivnlpgkpqsikvcldavmpaipycidliggayidtdpnkvkafr

SCOPe Domain Coordinates for d2pbqc_:

Click to download the PDB-style file with coordinates for d2pbqc_.
(The format of our PDB-style files is described here.)

Timeline for d2pbqc_: