Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.57: Molybdenum cofactor biosynthesis proteins [53217] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 5 strands; order: 21354, strand 5 is antiparallel to the rest; permutation of the Phosphorylase/hydrolase-like fold |
Superfamily c.57.1: Molybdenum cofactor biosynthesis proteins [53218] (3 families) |
Family c.57.1.1: MogA-like [53219] (6 proteins) |
Protein automated matches [190868] (2 species) not a true protein |
Species Aquifex aeolicus [TaxId:224324] [188216] (3 PDB entries) |
Domain d2pbqa_: 2pbq A: [167114] automated match to d2f7wa1 |
PDB Entry: 2pbq (more details), 1.7 Å
SCOPe Domain Sequences for d2pbqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pbqa_ c.57.1.1 (A:) automated matches {Aquifex aeolicus [TaxId: 224324]} kavigvvtisdraskgiyedisgkaiidylkdviitpfeveyrvipderdliektliela dekgcslilttggtgpaprdvtpeateavcekmlpgfgelmrqvslkqvptailsrqtag irgsclivnlpgkpqsikvcldavmpaipycidliggayidtdpnkvkafrpkk
Timeline for d2pbqa_: