SCOPe 2.06: Domain d2pbqa_: 2pbq A:

Lineage for d2pbqa_ (2pbq A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.57: Molybdenum cofactor biosynthesis proteins [53217] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 5 strands; order: 21354, strand 5 is antiparallel to the rest; permutation of the Phosphorylase/hydrolase-like fold

4. Superfamily c.57.1: Molybdenum cofactor biosynthesis proteins [53218] (3 families)

5. Family c.57.1.1: MogA-like [53219] (6 proteins)

6. Protein automated matches [190868] (2 species)
   not a true protein

7. Species Aquifex aeolicus [TaxId:224324] [188216] (3 PDB entries)

8. Domain d2pbqa_: 2pbq A: [167114]
   automated match to d2f7wa1

Details for d2pbqa_

PDB Entry: 2pbq, 1.7 Å

PDB Description: crystal structure of molybdenum cofactor biosynthesis (aq_061) from aquifex aeolicus vf5

PDB Compounds: (A:) Molybdenum cofactor biosynthesis MOG

SCOPe Domain Sequences for d2pbqa_:

Sequence; same for both SEQRES and ATOM records:

>d2pbqa_ c.57.1.1 (A:) automated matches {Aquifex aeolicus [TaxId: 224324]}
kavigvvtisdraskgiyedisgkaiidylkdviitpfeveyrvipderdliektliela
dekgcslilttggtgpaprdvtpeateavcekmlpgfgelmrqvslkqvptailsrqtag
irgsclivnlpgkpqsikvcldavmpaipycidliggayidtdpnkvkafrpkk

Timeline for d2pbqa_:

• d2pbqa_ first appeared in SCOPe 2.01
  
• d2pbqa_ appears in SCOPe 2.05
  
• d2pbqa_ appears in SCOPe 2.07
  
• d2pbqa_ appears in the current release, SCOPe 2.08