Lineage for d2pboa_ (2pbo A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2082160Family c.1.8.3: beta-glycanases [51487] (27 protein domains)
    consist of a number of sequence families
  6. 2082782Protein automated matches [190057] (26 species)
    not a true protein
  7. 2082904Species Yeast (Candida albicans) [TaxId:5476] [188406] (8 PDB entries)
  8. 2082907Domain d2pboa_: 2pbo A: [167113]
    automated match to d1cz1a_
    mutant

Details for d2pboa_

PDB Entry: 2pbo (more details), 1.85 Å

PDB Description: e27q mutant of exo-b-(1,3)-glucanase from candida albicans at 1.85 a
PDB Compounds: (A:) Hypothetical protein XOG1

SCOPe Domain Sequences for d2pboa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pboa_ c.1.8.3 (A:) automated matches {Yeast (Candida albicans) [TaxId: 5476]}
awdydnnvirgvnlggwfvlqpymtpslfepfqngndqsgvpvdeyhwtqtlgkeaalri
lqkhwstwiteqdfkqisnlglnfvripigywafqlldndpyvqgqvqylekalgwarkn
nirvwidlhgapgsqngfdnsglrdsynfqngdntqvtlnvlntifkkyggneysdvvig
iellneplgpvlnmdklkqffldgynslrqtgsvtpviihdafqvfgywnnfltvaegqw
nvvvdhhhyqvfsggelsrnindhisvacnwgwdakkeshwnvagewsaaltdcakwlng
vnrgaryegaydnapyigscqplldisqwsdehktdtrryieaqldafeytggwvfwswk
tenapewsfqtltynglfpqpvtdrqfpnqcgfh

SCOPe Domain Coordinates for d2pboa_:

Click to download the PDB-style file with coordinates for d2pboa_.
(The format of our PDB-style files is described here.)

Timeline for d2pboa_: