Lineage for d2pbfb_ (2pbf B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1864482Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 1864483Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) (S)
  5. 1865706Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 1865707Protein automated matches [190689] (49 species)
    not a true protein
  7. 1865904Species Plasmodium falciparum [TaxId:36329] [187826] (15 PDB entries)
  8. 1865934Domain d2pbfb_: 2pbf B: [167110]
    automated match to d1i1na_
    complexed with sah

Details for d2pbfb_

PDB Entry: 2pbf (more details), 2 Å

PDB Description: crystal structure of a putative protein-l-isoaspartate o- methyltransferase beta-aspartate methyltransferase (pcmt) from plasmodium falciparum in complex with s-adenosyl-l-homocysteine
PDB Compounds: (B:) Protein-L-isoaspartate O-methyltransferase beta-aspartate methyltransferase

SCOPe Domain Sequences for d2pbfb_:

Sequence, based on SEQRES records: (download)

>d2pbfb_ c.66.1.0 (B:) automated matches {Plasmodium falciparum [TaxId: 36329]}
ennhksllenlkrrgiiddddvyntmlqvdrgkyikeipyidtpvyishgvtisaphmha
lslkrlinvlkpgsraidvgsgsgyltvcmaikmnvlenknsyviglervkdlvnfslen
ikrdkpellkidnfkiihkniyqvneeekkelglfdaihvgasaselpeilvdllaengk
liipieedytqvlyeitkkngkiikdrlfdvcfvslkkn

Sequence, based on observed residues (ATOM records): (download)

>d2pbfb_ c.66.1.0 (B:) automated matches {Plasmodium falciparum [TaxId: 36329]}
ennhksllenlkrrgiiddddvyntmlqvdrgkyikeipyidtpvyishgvtisaphmha
lslkrlinvlkpgsraidvgsgsgyltvcmaikmnvlenknsyviglervkdlvnfslen
ikrdkpellkidnfkiihkniyqvneeekkelglfdaihvgasaselpeilvdllaengk
liipieedytqvlyeitkkngiikdrlfdvcfvslkkn

SCOPe Domain Coordinates for d2pbfb_:

Click to download the PDB-style file with coordinates for d2pbfb_.
(The format of our PDB-style files is described here.)

Timeline for d2pbfb_: