Lineage for d2paab_ (2paa B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2141948Fold c.86: Phosphoglycerate kinase [53747] (1 superfamily)
    consists of two non-similar domains, 3 layers (a/b/a) each
    Domain 1 has parallel beta-sheet of 6 strands, order 342156
    Domain 2 has parallel beta-sheet of 6 strands, order 321456
  4. 2141949Superfamily c.86.1: Phosphoglycerate kinase [53748] (2 families) (S)
  5. 2141950Family c.86.1.1: Phosphoglycerate kinase [53749] (2 protein domains)
    Domain 2 binds ATP
    automatically mapped to Pfam PF00162
  6. 2141985Protein automated matches [190709] (4 species)
    not a true protein
  7. 2142014Species Mouse (Mus musculus) [TaxId:10090] [188280] (4 PDB entries)
  8. 2142018Domain d2paab_: 2paa B: [167098]
    automated match to d1kf0a_
    complexed with 3pg, atp

Details for d2paab_

PDB Entry: 2paa (more details), 2.7 Å

PDB Description: crystal structure of phosphoglycerate kinase-2 bound to atp and 3pg
PDB Compounds: (B:) Phosphoglycerate kinase, testis specific

SCOPe Domain Sequences for d2paab_:

Sequence, based on SEQRES records: (download)

>d2paab_ c.86.1.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
akltldkvdlkgkrvimrvdfnvpmknnqitnnqrikaaipsikhcldngaksvvlmshl
grpdgipmpdkyslepvadelksllnkdviflkdcvgpeveqacanpdngsiillenlrf
hveeegkgkdssgkkisadpakveafraslsklgdvyvndafgtahrahssmvgvnlpqk
asgflmkkeldyfskalekperpflailggakvkdkiqliknmldkvnfmiigggmaytf
lkelknmqigaslfdeegativkeimekaekngvkivfpvdfvtgdkfdenakvgqatie
sgipsgwmgldcgpesikinaqivaqaklivwngpigvfewdafakgtkalmdevvkats
ngcvtiigggdtatccakwgtedkvshvstgggaslellegkilpgvealsnm

Sequence, based on observed residues (ATOM records): (download)

>d2paab_ c.86.1.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
akltldkvdlkgkrvimrvdfnvpmknnqitnnqrikaaipsikhcldngaksvvlmshl
grpdgipmpdkyslepvadelksllnkdviflkdcvgpeveqacanpdngsiillenlrf
hveeegkgkdssgkkisadpakveafraslsklgdvyvndafgtahrahssmvgvnlpqk
asgflmkkeldyfskalekperpflailggakvkdkiqliknmldkvnfmiigggmaytf
lkelknmqigaslfdeegativkeimekaekngvkivfpvdfvtgdkfdenakvgqatie
sgipsgwmgldcgpesikinaqivaqaklivwngpigvfewdafakgtkalmdevvkats
ngcvtiigkvshvstgggaslellegkilpgvealsnm

SCOPe Domain Coordinates for d2paab_:

Click to download the PDB-style file with coordinates for d2paab_.
(The format of our PDB-style files is described here.)

Timeline for d2paab_: