Lineage for d2p9yb_ (2p9y B:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 998539Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest
  4. 998540Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (3 families) (S)
  5. 998541Family c.60.1.1: Cofactor-dependent phosphoglycerate mutase [53255] (4 proteins)
  6. 998593Protein automated matches [190196] (7 species)
    not a true protein
  7. 998656Species Thermus thermophilus [TaxId:300852] [187129] (15 PDB entries)
  8. 998680Domain d2p9yb_: 2p9y B: [167091]
    automated match to d1v37a_
    complexed with gol, na

Details for d2p9yb_

PDB Entry: 2p9y (more details), 1.85 Å

PDB Description: crystal structure of tthb049 from thermus thermophilus hb8
PDB Compounds: (B:) Alpha-ribazole-5'-phosphate phosphatase

SCOPe Domain Sequences for d2p9yb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p9yb_ c.60.1.1 (B:) automated matches {Thermus thermophilus [TaxId: 300852]}
melwlvrhgetlwnregrllgwtdlpltaegeaqarrlkgalpslpafssdllrarrtae
lagfsprlypelreihfgalegalwetmdprykeallrfqgfhppggeslsafqervfrf
leglkapavlfthggvvravlralgedglvppgsavavdwprrvlvrlal

SCOPe Domain Coordinates for d2p9yb_:

Click to download the PDB-style file with coordinates for d2p9yb_.
(The format of our PDB-style files is described here.)

Timeline for d2p9yb_: