Lineage for d1mfrr_ (1mfr R:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 353826Fold a.25: Ferritin-like [47239] (2 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 353827Superfamily a.25.1: Ferritin-like [47240] (3 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 353828Family a.25.1.1: Ferritin [47241] (7 proteins)
  6. 353829Protein (Apo)ferritin [47246] (4 species)
  7. 353830Species Bullfrog (Rana catesbeiana) [TaxId:8400] [47249] (7 PDB entries)
  8. 353854Domain d1mfrr_: 1mfr R: [16709]

Details for d1mfrr_

PDB Entry: 1mfr (more details), 2.8 Å

PDB Description: crystal structure of m ferritin

SCOP Domain Sequences for d1mfrr_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mfrr_ a.25.1.1 (R:) (Apo)ferritin {Bullfrog (Rana catesbeiana)}
vsqvrqnyhsdceaavnrmlnlelyasytyssmyaffdrddvalhnvaeffkehsheere
haekfmkyqnkrggrvvlqdikkperdewgntleamqaalqlektvnqalldlhklatdk
vdphlcdfleseyleeqvkdikrigdfitnlkrlglpengmgeylfdkhsv

SCOP Domain Coordinates for d1mfrr_:

Click to download the PDB-style file with coordinates for d1mfrr_.
(The format of our PDB-style files is described here.)

Timeline for d1mfrr_: