Lineage for d2p9ta_ (2p9t A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2159429Fold c.86: Phosphoglycerate kinase [53747] (1 superfamily)
    consists of two non-similar domains, 3 layers (a/b/a) each
    Domain 1 has parallel beta-sheet of 6 strands, order 342156
    Domain 2 has parallel beta-sheet of 6 strands, order 321456
  4. 2159430Superfamily c.86.1: Phosphoglycerate kinase [53748] (2 families) (S)
  5. 2159431Family c.86.1.1: Phosphoglycerate kinase [53749] (2 proteins)
    Domain 2 binds ATP
    automatically mapped to Pfam PF00162
  6. 2159466Protein automated matches [190709] (4 species)
    not a true protein
  7. 2159498Species Mouse (Mus musculus) [TaxId:10090] [188280] (4 PDB entries)
  8. 2159499Domain d2p9ta_: 2p9t A: [167089]
    automated match to d1kf0a_
    complexed with 3pg

Details for d2p9ta_

PDB Entry: 2p9t (more details), 2 Å

PDB Description: crystal structure of phosphoglycerate kinase-2 bound to 3- phosphoglycerate
PDB Compounds: (A:) Phosphoglycerate kinase, testis specific

SCOPe Domain Sequences for d2p9ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p9ta_ c.86.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
akltldkvdlkgkrvimrvdfnvpmknnqitnnqrikaaipsikhcldngaksvvlmshl
grpdgipmpdkyslepvadelksllnkdviflkdcvgpeveqacanpdngsiillenlrf
hveeegkgkdssgkkisadpakveafraslsklgdvyvndafgtahrahssmvgvnlpqk
asgflmkkeldyfskalekperpflailggakvkdkiqliknmldkvnfmiigggmaytf
lkelknmqigaslfdeegativkeimekaekngvkivfpvdfvtgdkfdenakvgqatie
sgipsgwmgldcgpesikinaqivaqaklivwngpigvfewdafakgtkalmdevvkats
ngcvtiigggdtatccakwgtedkvshvstgggaslellegkilpgvealsnm

SCOPe Domain Coordinates for d2p9ta_:

Click to download the PDB-style file with coordinates for d2p9ta_.
(The format of our PDB-style files is described here.)

Timeline for d2p9ta_: