Lineage for d2p9qa_ (2p9q A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2141948Fold c.86: Phosphoglycerate kinase [53747] (1 superfamily)
    consists of two non-similar domains, 3 layers (a/b/a) each
    Domain 1 has parallel beta-sheet of 6 strands, order 342156
    Domain 2 has parallel beta-sheet of 6 strands, order 321456
  4. 2141949Superfamily c.86.1: Phosphoglycerate kinase [53748] (2 families) (S)
  5. 2141950Family c.86.1.1: Phosphoglycerate kinase [53749] (2 protein domains)
    Domain 2 binds ATP
    automatically mapped to Pfam PF00162
  6. 2141985Protein automated matches [190709] (4 species)
    not a true protein
  7. 2142014Species Mouse (Mus musculus) [TaxId:10090] [188280] (4 PDB entries)
  8. 2142019Domain d2p9qa_: 2p9q A: [167087]
    automated match to d1kf0a_

Details for d2p9qa_

PDB Entry: 2p9q (more details), 2.7 Å

PDB Description: crystal structure of phosphoglycerate kinase-2
PDB Compounds: (A:) Phosphoglycerate kinase, testis specific

SCOPe Domain Sequences for d2p9qa_:

Sequence, based on SEQRES records: (download)

>d2p9qa_ c.86.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
alsakltldkvdlkgkrvimrvdfnvpmknnqitnnqrikaaipsikhcldngaksvvlm
shlgrpdgipmpdkyslepvadelksllnkdviflkdcvgpeveqacanpdngsiillen
lrfhveeegkgkdssgkkisadpakveafraslsklgdvyvndafgtahrahssmvgvnl
pqkasgflmkkeldyfskalekperpflailggakvkdkiqliknmldkvnfmiigggma
ytflkelknmqigaslfdeegativkeimekaekngvkivfpvdfvtgdkfdenakvgqa
tiesgipsgwmgldcgpesikinaqivaqaklivwngpigvfewdafakgtkalmdevvk
atsngcvtiigggdtatccakwgtedkvshvstgggaslellegkilpgvealsnm

Sequence, based on observed residues (ATOM records): (download)

>d2p9qa_ c.86.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
alsakltldkvdlkgkrvimrvdfnvpmknnqitnnqrikaaipsikhcldngaksvvlm
shlgrpdgipmpdkyslepvadelksllnkdviflkdcvgpeveqacanpdngsiillen
lrfhveeegkgkdssgkkisadpakveafraslsklgdvyvndafgtahrahssmvgvnl
pqkasgflmkkeldyfskalekperpflailggakvkdkiqliknmldkvnfmiigggma
ytflkelknmqigaslfdeegativkeimekaekngvkivfpvdfvtgdkfdenakvgqa
tiesgipsgwmgldcgpesikinaqivaqaklivwngpigvfewdafakgtkalmdevvk
atsngcvtiiggedkvshvstgggaslellegkilpgvealsnm

SCOPe Domain Coordinates for d2p9qa_:

Click to download the PDB-style file with coordinates for d2p9qa_.
(The format of our PDB-style files is described here.)

Timeline for d2p9qa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2p9qb_