SCOPe 2.01: Domain d2p7ua_: 2p7u A:

Lineage for d2p7ua_ (2p7u A:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (23 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.1: Papain-like [54002] (26 proteins)

6. Protein automated matches [190264] (8 species)
   not a true protein

7. Species Trypanosoma brucei [TaxId:31286] [188393] (2 PDB entries)

8. Domain d2p7ua_: 2p7u A: [167079]
   automated match to d1ewla_
   complexed with d1r

Details for d2p7ua_

PDB Entry: 2p7u, 1.65 Å

PDB Description: the crystal structure of rhodesain, the major cysteine protease of t. brucei rhodesiense, bound to inhibitor k777

PDB Compounds: (A:) Cysteine protease

SCOPe Domain Sequences for d2p7ua_:

Sequence; same for both SEQRES and ATOM records:

>d2p7ua_ d.3.1.1 (A:) automated matches {Trypanosoma brucei [TaxId: 31286]}
apaavdwrekgavtpvkdqgqcgscwafstigniegqwqvagnplvslseqmlvscdtid
fgcggglmdnafnwivnsnggnvfteasypyvsgngeqpqcqmngheigaaitdhvdlpq
dedaiaaylaengplaiavdatsfmdynggiltsctseqldhgvllvgyndasnppywii
knswsnmwgedgyiriekgtnqclmnqavssavvg

Timeline for d2p7ua_:

• d2p7ua_ is new in SCOPe 2.01-stable
  
• d2p7ua_ appears in SCOPe 2.02
  
• d2p7ua_ appears in the current release, SCOPe 2.08