Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.5: RNase A-like [54075] (1 superfamily) contains long curved beta-sheet and 3 helices |
Superfamily d.5.1: RNase A-like [54076] (2 families) can be classified as disulfide-rich |
Family d.5.1.0: automated matches [191478] (1 protein) not a true family |
Protein automated matches [190767] (7 species) not a true protein |
Species Frog (Rana pipiens) [TaxId:8404] [187984] (2 PDB entries) |
Domain d2p7sa_: 2p7s A: [167078] automated match to d1bc4a_ complexed with act, gol |
PDB Entry: 2p7s (more details), 1.8 Å
SCOPe Domain Sequences for d2p7sa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2p7sa_ d.5.1.0 (A:) automated matches {Frog (Rana pipiens) [TaxId: 8404]} drewekfktkhitsqsvadfncnrtmndpaytpdgqckpintfihsttgpvkeicrratg rvnksstqqftlttcknpirckysqsnttnficitcrdnypvhfvktgkc
Timeline for d2p7sa_: