Lineage for d2p7sa_ (2p7s A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2928015Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 2928016Superfamily d.5.1: RNase A-like [54076] (2 families) (S)
    can be classified as disulfide-rich
  5. 2928655Family d.5.1.0: automated matches [191478] (1 protein)
    not a true family
  6. 2928656Protein automated matches [190767] (7 species)
    not a true protein
  7. 2928668Species Frog (Rana pipiens) [TaxId:8404] [187984] (2 PDB entries)
  8. 2928669Domain d2p7sa_: 2p7s A: [167078]
    automated match to d1bc4a_
    complexed with act, gol

Details for d2p7sa_

PDB Entry: 2p7s (more details), 1.8 Å

PDB Description: enzymatic and structural characterisation of amphinase, a novel cytotoxic ribonuclease from rana pipiens oocytes
PDB Compounds: (A:) Amphinase-2

SCOPe Domain Sequences for d2p7sa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p7sa_ d.5.1.0 (A:) automated matches {Frog (Rana pipiens) [TaxId: 8404]}
drewekfktkhitsqsvadfncnrtmndpaytpdgqckpintfihsttgpvkeicrratg
rvnksstqqftlttcknpirckysqsnttnficitcrdnypvhfvktgkc

SCOPe Domain Coordinates for d2p7sa_:

Click to download the PDB-style file with coordinates for d2p7sa_.
(The format of our PDB-style files is described here.)

Timeline for d2p7sa_: