Lineage for d2p7qe_ (2p7q E:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2942376Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 2942377Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) (S)
  5. 2942433Family d.32.1.2: Antibiotic resistance proteins [54598] (8 proteins)
    duplication: consists of two clear structural repeats each having this fold
    subunit fold and dimeric assembly are similar to those of glyoxalase
  6. 2942498Protein automated matches [190190] (5 species)
    not a true protein
  7. 2942499Species Listeria monocytogenes [TaxId:169963] [187361] (5 PDB entries)
  8. 2942524Domain d2p7qe_: 2p7q E: [167076]
    automated match to d1r9ca_
    complexed with gg6, mn; mutant

Details for d2p7qe_

PDB Entry: 2p7q (more details), 2.4 Å

PDB Description: crystal structure of e126q mutant of genomically encoded fosfomycin resistance protein, fosx, from listeria monocytogenes complexed with mn(ii) and 1s,2s-dihydroxypropylphosphonic acid
PDB Compounds: (E:) Glyoxalase family protein

SCOPe Domain Sequences for d2p7qe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p7qe_ d.32.1.2 (E:) automated matches {Listeria monocytogenes [TaxId: 169963]}
misglshitlivkdlnkttaflqnifnaeeiyssgdktfslskekffliaglwicimegd
slqertynhiafqiqseevdeyterikalgvemkperprvqgegrsiyfydfdnhlfelh
agtleqrlkry

SCOPe Domain Coordinates for d2p7qe_:

Click to download the PDB-style file with coordinates for d2p7qe_.
(The format of our PDB-style files is described here.)

Timeline for d2p7qe_: