SCOPe 2.01: Domain d2p7qd_: 2p7q D:

Lineage for d2p7qd_ (2p7q D:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families)

5. Family d.32.1.2: Antibiotic resistance proteins [54598] (8 proteins)
   duplication: consists of two clear structural repeats each having this fold
   subunit fold and dimeric assembly are similar to those of glyoxalase

6. Protein automated matches [190190] (4 species)
   not a true protein

7. Species Listeria monocytogenes [TaxId:169963] [187361] (5 PDB entries)

8. Domain d2p7qd_: 2p7q D: [167075]
   automated match to d1r9ca_
   complexed with gg6, mn; mutant

Details for d2p7qd_

PDB Entry: 2p7q, 2.4 Å

PDB Description: crystal structure of e126q mutant of genomically encoded fosfomycin resistance protein, fosx, from listeria monocytogenes complexed with mn(ii) and 1s,2s-dihydroxypropylphosphonic acid

PDB Compounds: (D:) Glyoxalase family protein

SCOPe Domain Sequences for d2p7qd_:

Sequence, based on SEQRES records:

>d2p7qd_ d.32.1.2 (D:) automated matches {Listeria monocytogenes [TaxId: 169963]}
misglshitlivkdlnkttaflqnifnaeeiyssgdktfslskekffliaglwicimegd
slqertynhiafqiqseevdeyterikalgvemkperprvqgegrsiyfydfdnhlfelh
agtleqrlkryh

Sequence, based on observed residues (ATOM records):

>d2p7qd_ d.32.1.2 (D:) automated matches {Listeria monocytogenes [TaxId: 169963]}
misglshitlivkdlnkttaflqnifnaeeiyssgskekffliaglwicimegdslqert
ynhiafqiqseevdeyterikalgvemkperprvqgegrsiyfydfdnhlfelhagtleq
rlkryh

Timeline for d2p7qd_:

• d2p7qd_ is new in SCOPe 2.01-stable
  
• d2p7qd_ appears in SCOPe 2.02
  
• d2p7qd_ appears in the current release, SCOPe 2.08