Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily) beta-alpha-beta(3); 2 layers: alpha/beta |
Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) |
Family d.32.1.2: Antibiotic resistance proteins [54598] (8 proteins) duplication: consists of two clear structural repeats each having this fold subunit fold and dimeric assembly are similar to those of glyoxalase |
Protein automated matches [190190] (5 species) not a true protein |
Species Listeria monocytogenes [TaxId:169963] [187361] (5 PDB entries) |
Domain d2p7pf_: 2p7p F: [167071] automated match to d1r9ca_ complexed with mn, so4 |
PDB Entry: 2p7p (more details), 2.17 Å
SCOPe Domain Sequences for d2p7pf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2p7pf_ d.32.1.2 (F:) automated matches {Listeria monocytogenes [TaxId: 169963]} misglshitlivkdlnkttaflqnifnaeeiyssgdktfslskekffliaglwicimegd slqertynhiafqiqseevdeyterikalgvemkperprvqgegrsiyfydfdnhlfelh agtleerlkry
Timeline for d2p7pf_: