Lineage for d2p7pe_ (2p7p E:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2186669Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 2186670Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) (S)
  5. 2186724Family d.32.1.2: Antibiotic resistance proteins [54598] (8 proteins)
    duplication: consists of two clear structural repeats each having this fold
    subunit fold and dimeric assembly are similar to those of glyoxalase
  6. 2186789Protein automated matches [190190] (5 species)
    not a true protein
  7. 2186790Species Listeria monocytogenes [TaxId:169963] [187361] (5 PDB entries)
  8. 2186803Domain d2p7pe_: 2p7p E: [167070]
    automated match to d1r9ca_
    complexed with mn, so4

Details for d2p7pe_

PDB Entry: 2p7p (more details), 2.17 Å

PDB Description: Crystal structure of genomically encoded fosfomycin resistance protein, FosX, from Listeria monocytogenes complexed with MN(II) and sulfate ion
PDB Compounds: (E:) Glyoxalase family protein

SCOPe Domain Sequences for d2p7pe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p7pe_ d.32.1.2 (E:) automated matches {Listeria monocytogenes [TaxId: 169963]}
misglshitlivkdlnkttaflqnifnaeeiyssgdktfslskekffliaglwicimegd
slqertynhiafqiqseevdeyterikalgvemkperprvqgegrsiyfydfdnhlfelh
agtleerlkry

SCOPe Domain Coordinates for d2p7pe_:

Click to download the PDB-style file with coordinates for d2p7pe_.
(The format of our PDB-style files is described here.)

Timeline for d2p7pe_: