Lineage for d1mfrp_ (1mfr P:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 279616Fold a.25: Ferritin-like [47239] (2 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 279617Superfamily a.25.1: Ferritin-like [47240] (2 families) (S)
    contains dimetal-ion centre in the middle of the bundle
  5. 279618Family a.25.1.1: Ferritin [47241] (5 proteins)
  6. 279619Protein (Apo)ferritin [47246] (4 species)
  7. 279620Species Bullfrog (Rana catesbeiana) [TaxId:8400] [47249] (7 PDB entries)
  8. 279642Domain d1mfrp_: 1mfr P: [16707]

Details for d1mfrp_

PDB Entry: 1mfr (more details), 2.8 Å

PDB Description: crystal structure of m ferritin

SCOP Domain Sequences for d1mfrp_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mfrp_ a.25.1.1 (P:) (Apo)ferritin {Bullfrog (Rana catesbeiana)}
vsqvrqnyhsdceaavnrmlnlelyasytyssmyaffdrddvalhnvaeffkehsheere
haekfmkyqnkrggrvvlqdikkperdewgntleamqaalqlektvnqalldlhklatdk
vdphlcdfleseyleeqvkdikrigdfitnlkrlglpengmgeylfdkhsv

SCOP Domain Coordinates for d1mfrp_:

Click to download the PDB-style file with coordinates for d1mfrp_.
(The format of our PDB-style files is described here.)

Timeline for d1mfrp_: