Lineage for d2p7pd_ (2p7p D:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2549433Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 2549434Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) (S)
  5. 2549490Family d.32.1.2: Antibiotic resistance proteins [54598] (8 proteins)
    duplication: consists of two clear structural repeats each having this fold
    subunit fold and dimeric assembly are similar to those of glyoxalase
  6. 2549555Protein automated matches [190190] (5 species)
    not a true protein
  7. 2549556Species Listeria monocytogenes [TaxId:169963] [187361] (5 PDB entries)
  8. 2549568Domain d2p7pd_: 2p7p D: [167069]
    automated match to d1r9ca_
    complexed with mn, so4

Details for d2p7pd_

PDB Entry: 2p7p (more details), 2.17 Å

PDB Description: Crystal structure of genomically encoded fosfomycin resistance protein, FosX, from Listeria monocytogenes complexed with MN(II) and sulfate ion
PDB Compounds: (D:) Glyoxalase family protein

SCOPe Domain Sequences for d2p7pd_:

Sequence, based on SEQRES records: (download)

>d2p7pd_ d.32.1.2 (D:) automated matches {Listeria monocytogenes [TaxId: 169963]}
misglshitlivkdlnkttaflqnifnaeeiyssgdktfslskekffliaglwicimegd
slqertynhiafqiqseevdeyterikalgvemkperprvqgegrsiyfydfdnhlfelh
agtleerlkryh

Sequence, based on observed residues (ATOM records): (download)

>d2p7pd_ d.32.1.2 (D:) automated matches {Listeria monocytogenes [TaxId: 169963]}
misglshitlivkdlnkttaflqnifnaeeiyssskekffliaglwicimegdslqerty
nhiafqiqseevdeyterikalgvemkperprvqgegrsiyfydfdnhlfelhagtleer
lkryh

SCOPe Domain Coordinates for d2p7pd_:

Click to download the PDB-style file with coordinates for d2p7pd_.
(The format of our PDB-style files is described here.)

Timeline for d2p7pd_: