Lineage for d2p7me_ (2p7m E:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2510574Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 2510575Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) (S)
  5. 2510629Family d.32.1.2: Antibiotic resistance proteins [54598] (8 protein domains)
    duplication: consists of two clear structural repeats each having this fold
    subunit fold and dimeric assembly are similar to those of glyoxalase
  6. 2510694Protein automated matches [190190] (5 species)
    not a true protein
  7. 2510695Species Listeria monocytogenes [TaxId:169963] [187361] (5 PDB entries)
  8. 2510702Domain d2p7me_: 2p7m E: [167062]
    automated match to d1r9ca_

Details for d2p7me_

PDB Entry: 2p7m (more details), 1.85 Å

PDB Description: Crystal structure of monoclinic form of genomically encoded fosfomycin resistance protein, FosX, from Listeria monocytogenes at pH 6.5
PDB Compounds: (E:) Glyoxalase family protein

SCOPe Domain Sequences for d2p7me_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p7me_ d.32.1.2 (E:) automated matches {Listeria monocytogenes [TaxId: 169963]}
misglshitlivkdlnkttaflqnifnaeeiyssgdktfslskekffliaglwicimegd
slqertynhiafqiqseevdeyterikalgvemkperprvqgegrsiyfydfdnhlfelh
agtleerl

SCOPe Domain Coordinates for d2p7me_:

Click to download the PDB-style file with coordinates for d2p7me_.
(The format of our PDB-style files is described here.)

Timeline for d2p7me_: